PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS72277.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB_related
Protein Properties Length: 348aa    MW: 39749.4 Da    PI: 9.5692
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS72277.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.42.8e-07129171346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT+eE ++l d+++++  + +  +a +++ +++ +++k+r+++
       EPS72277.1 129 NWTKEETDQLFDLCQRFDLR-FIVVADRFPSTKSVEELKDRYYT 171
                      8*******************.*********99**********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162828.5E-31102176IPR032563DAMP1, SANT/Myb-like domain
SMARTSM007173.2E-7126175IPR001005SANT/Myb domain
SuperFamilySSF466894.37E-6129173IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-5129174IPR009057Homeodomain-like
PfamPF054996.9E-6274344IPR008468DNA methyltransferase 1-associated 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0000812Cellular ComponentSwr1 complex
GO:0035267Cellular ComponentNuA4 histone acetyltransferase complex
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MDAKDILGLP KNTLPIQEKK SRPSRESQRK PDGVSREVYA LTGGLPPLMP AVDPSQLKRK  60
TQAENEKITW QWLPFSNSAR KDDLQLYHWV RVVNGVPPTG DYSFAKYNKS VDVIKYTDEE  120
YEKYLADPNW TKEETDQLFD LCQRFDLRFI VVADRFPSTK SVEELKDRYY TVARAILIAR  180
APSPNDISGH PLVKMKYNAS QETERKRALN LVLSHTKQQE RKDVEASREQ PELPASVDKE  240
PFAANTINPS SNPQLPFVPG SNPVSETASV LASLRMLHVY LRSYAHVQMV EAVSSSAAIR  300
TIKRVEQTLQ DLRLNLKPKI PTKAVCAEHL ELRKDILILL DLQRQVRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A3e-21101186493DNA methyltransferase 1-associated protein 1
4iej_A3e-21101186493DNA methyltransferase 1-associated protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011079518.10.0PREDICTED: DNA methyltransferase 1-associated protein 1
SwissprotQ8VZL61e-158SWC4_ARATH; SWR1-complex protein 4
TrEMBLS8EHT80.0S8EHT8_9LAMI; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000233830.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA76261515
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.11e-160MYB_related family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]